Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAPTM4A Rabbit Polyclonal Antibody (FITC)

LAPTM4A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MBNT, Mtrp, LAPTM4, HUMORF13

UniProt

Q15012

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LAPTM4A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFA

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055528

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Urinalysis Reagent Strips - 12 parameters
U032-12 100 Tests

Urinalysis Reagent Strips - 12 parameters

Sign In for Pricing
View Details
Microscope slide tray from plasticware Material: HIPS 20 Slides
5050950 1 Each

Microscope slide tray from plasticware Material: HIPS 20 Slides

Sign In for Pricing
View Details
SCYL1, NT (SCYL1, CVAK90, GKLP, NTKL, TAPK, TEIF, TRAP, N-terminal kinase-like protein, Coated vesicle-associated kinase of 90kD, SCY1-like protein 1, Telomerase regulation-associated protein, Telomerase transcriptional element-interacting factor, Teratom
MBS6345473-01 0.2 mL

SCYL1, NT (SCYL1, CVAK90, GKLP, NTKL, TAPK, TEIF, TRAP, N-terminal kinase-like protein, Coated vesicle-associated kinase of 90kD, SCY1-like protein 1, Telomerase regulation-associated protein, Telomerase transcriptional element-interacting factor, Teratom

Sign In for Pricing
View Details
SCYL1, NT (SCYL1, CVAK90, GKLP, NTKL, TAPK, TEIF, TRAP, N-terminal kinase-like protein, Coated vesicle-associated kinase of 90kD, SCY1-like protein 1, Telomerase regulation-associated protein, Telomerase transcriptional element-interacting factor, Teratom
MBS6345473-02 5x 0.2 mL

SCYL1, NT (SCYL1, CVAK90, GKLP, NTKL, TAPK, TEIF, TRAP, N-terminal kinase-like protein, Coated vesicle-associated kinase of 90kD, SCY1-like protein 1, Telomerase regulation-associated protein, Telomerase transcriptional element-interacting factor, Teratom

Sign In for Pricing
View Details
Bovine Coagulation Factor XI ELISA Kit
MBS743999-01 48 Well

Bovine Coagulation Factor XI ELISA Kit

Sign In for Pricing
View Details
Bovine Coagulation Factor XI ELISA Kit
MBS743999-02 96 Well

Bovine Coagulation Factor XI ELISA Kit

Sign In for Pricing
View Details