Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLSTN3 Rabbit Polyclonal Antibody (Biotin)

CLSTN3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CSTN3, CDHR14, alcbeta

UniProt

Q9BQT9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CLSTN3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QICYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

106kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055533

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Collagen Type XVII ELISA Kit
MBS754868-01 48 Well

Sheep Collagen Type XVII ELISA Kit

Sign In for Pricing
View Details
Sheep Collagen Type XVII ELISA Kit
MBS754868-02 96 Well

Sheep Collagen Type XVII ELISA Kit

Sign In for Pricing
View Details
Sheep Collagen Type XVII ELISA Kit
MBS754868-03 5x 96 Well

Sheep Collagen Type XVII ELISA Kit

Sign In for Pricing
View Details
Sheep Collagen Type XVII ELISA Kit
MBS754868-04 10x 96 Well

Sheep Collagen Type XVII ELISA Kit

Sign In for Pricing
View Details
2,3-dimethyl-4- (((4-nitrophenyl) sulfonyl) amino) -1-phenyl-3-pyrazolin-5-one
BMA33217 250 mg

2,3-dimethyl-4- (((4-nitrophenyl) sulfonyl) amino) -1-phenyl-3-pyrazolin-5-one

Sign In for Pricing
View Details
EDTA dipotassium salt dihydrate powdered pure
LC-10442.1 10 Kg

EDTA dipotassium salt dihydrate powdered pure

Sign In for Pricing
View Details