Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLSTN3 Rabbit Polyclonal Antibody (HRP)

CLSTN3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CSTN3, CDHR14, alcbeta

UniProt

Q9BQT9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CLSTN3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QICYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

106kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055533

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HAVCR1/KIM-1 Antibody
orb1537807 0.05 mg

HAVCR1/KIM-1 Antibody

Sign In for Pricing
View Details
SCRIPT Direct RT-qPCR ProbesMaster UNG (S pack)
JBS-PCR-530S 2x 1.25 mL

SCRIPT Direct RT-qPCR ProbesMaster UNG (S pack)

Sign In for Pricing
View Details
LOC100046079 3'UTR Luciferase Stable Cell Line
TU111472 1.0 mL

LOC100046079 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Salmonella typhi Nucleoside diphosphate kinase (ndk)
MBS1075374-01 0.02 mg (E-Coli)

Recombinant Salmonella typhi Nucleoside diphosphate kinase (ndk)

Sign In for Pricing
View Details
Recombinant Salmonella typhi Nucleoside diphosphate kinase (ndk)
MBS1075374-02 0.1 mg (E-Coli)

Recombinant Salmonella typhi Nucleoside diphosphate kinase (ndk)

Sign In for Pricing
View Details
Recombinant Salmonella typhi Nucleoside diphosphate kinase (ndk)
MBS1075374-03 0.02 mg (Yeast)

Recombinant Salmonella typhi Nucleoside diphosphate kinase (ndk)

Sign In for Pricing
View Details