Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM9SF4 Rabbit Polyclonal Antibody (FITC)

TM9SF4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DJ836N17.2

UniProt

Q92544

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TM9SF4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HQNDPVEIKAVKLTSSRTQLPYEYYSLPFCQPSKITYKAENLGEVLRGDR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055557

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tescalcin Antibody
E38QA6172 100 µL

Tescalcin Antibody

Sign In for Pricing
View Details
CXCL16 siRNA (Mouse)
CRM6426-01 15 nmol

CXCL16 siRNA (Mouse)

Sign In for Pricing
View Details
CXCL16 siRNA (Mouse)
CRM6426-02 30 nmol

CXCL16 siRNA (Mouse)

Sign In for Pricing
View Details
Rabbit Monoclonal Cytokeratin 7 Antibody (KRT7/8121R) [Alexa Fluor 350]
NBP3-20720AF350 0.1 mL

Rabbit Monoclonal Cytokeratin 7 Antibody (KRT7/8121R) [Alexa Fluor 350]

Sign In for Pricing
View Details
SLC25A23 (Calcium-binding Mitochondrial Carrier Protein SCaMC-3, Mitochondrial ATP-Mg/Pi Carrier Protein 2, Mitochondrial Ca (2+) -dependent Solute Carrier Protein 2, Small Calcium-binding Mitochondrial Carrier Protein 3, Solute Carrier Family 25 Member 23, (APC) 2, MCSC2, SCAMC3) (APC)
133438-APC 100 µL

SLC25A23 (Calcium-binding Mitochondrial Carrier Protein SCaMC-3, Mitochondrial ATP-Mg/Pi Carrier Protein 2, Mitochondrial Ca (2+) -dependent Solute Carrier Protein 2, Small Calcium-binding Mitochondrial Carrier Protein 3, Solute Carrier Family 25 Member 23, (APC) 2, MCSC2, SCAMC3) (APC)

Sign In for Pricing
View Details
Rat SLC36A2 shRNA Plasmid
abx987956-01 150 µg

Rat SLC36A2 shRNA Plasmid

Sign In for Pricing
View Details