Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM9SF4 Rabbit Polyclonal Antibody (HRP)

TM9SF4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DJ836N17.2

UniProt

Q92544

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TM9SF4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HQNDPVEIKAVKLTSSRTQLPYEYYSLPFCQPSKITYKAENLGEVLRGDR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055557

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B3GNTL1 CRISPRa sgRNA lentivector (set of three targets)(Rat)
12946126 3x 1.0µg DNA

B3GNTL1 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
VIMENTIN Antibody - C-terminal region
OABB01842-100UG 100 µg/Vial

VIMENTIN Antibody - C-terminal region

Sign In for Pricing
View Details
Adiponectin Receptor 1 (ADIPOR1) Monkey ELISA Kit
B3001 96 Tests

Adiponectin Receptor 1 (ADIPOR1) Monkey ELISA Kit

Sign In for Pricing
View Details
Human IgE Mouse Monoclonal Antibody [Clone ID: IA2]
SM1815HRP 500 µg

Human IgE Mouse Monoclonal Antibody [Clone ID: IA2]

Sign In for Pricing
View Details
MAS1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1271606 1.0 µg DNA

MAS1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Monkey Tumor Protein P53-Inducible Nuclear Protein 1 (TP53INP1) ELISA Kit
MBS9392966-01 48 Well

Monkey Tumor Protein P53-Inducible Nuclear Protein 1 (TP53INP1) ELISA Kit

Sign In for Pricing
View Details