Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MINAR1 Rabbit Polyclonal Antibody (HRP)

MINAR1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

UBTOR, KIAA1024

UniProt

Q9UPX6

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human KIAA1024

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DNKDWHRKSKEADRQYDIPPQHRLPKQPKDGFLVEQVFSPHPYPASLKAH

Field of Research

Cardiovascular Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

103kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056021

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Leucine Rich Alpha-2-Glycoprotein 1 (LRG1) High Sensitivity BioAssayTM ELISA Kit (Human)
517393 96 Tests

Leucine Rich Alpha-2-Glycoprotein 1 (LRG1) High Sensitivity BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Tranylcypromine Hemisulfate
1816-100 100 mg

Tranylcypromine Hemisulfate

Sign In for Pricing
View Details
NDST4 (HSST4, Bifunctional Heparan Sulfate N-deacetylase/N-sulfotransferase 4, Glucosaminyl N-deacetylase/N-sulfotransferase 4, N-heparan Sulfate Sulfotransferase 4, Heparan Sulfate N-deacetylase 4, Heparan Sulfate N-sulfotransferase 4) (PE)
130204-PE 100 µL

NDST4 (HSST4, Bifunctional Heparan Sulfate N-deacetylase/N-sulfotransferase 4, Glucosaminyl N-deacetylase/N-sulfotransferase 4, N-heparan Sulfate Sulfotransferase 4, Heparan Sulfate N-deacetylase 4, Heparan Sulfate N-sulfotransferase 4) (PE)

Sign In for Pricing
View Details
Human Parvalbumin alpha ELISA Kit
MBS761129-01 48 Well

Human Parvalbumin alpha ELISA Kit

Sign In for Pricing
View Details
Human Parvalbumin alpha ELISA Kit
MBS761129-02 96 Well

Human Parvalbumin alpha ELISA Kit

Sign In for Pricing
View Details
Human Parvalbumin alpha ELISA Kit
MBS761129-03 5x 96 Well

Human Parvalbumin alpha ELISA Kit

Sign In for Pricing
View Details