Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARM1 Rabbit Polyclonal Antibody (HRP)

PARM1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

WSC4, Cipar1, PARM-1, DKFZP564O0823

UniProt

Q6UWI2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PARM1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GSNWEGTNTDPSPSGFSSTSGGVHLTTTLEEHSSGTPEAGVAATLSQSAA

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_056208

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PSENEN qPCR Primer Pair
QH46021S 200 Tests

Human PSENEN qPCR Primer Pair

Sign In for Pricing
View Details
SPTAN1 ORF Vector (Human) (pORF)
45414011 1.0 µg DNA

SPTAN1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
NDST4, NT (NDST4, HSST4, Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4, Glucosaminyl N-deacetylase/N-sulfotransferase 4, N-heparan sulfate sulfotransferase 4, Heparan sulfate N-deacetylase 4, Heparan sulfate N-sulfotransferase 4) (APC) discontinued
038852-APC 200 µL

NDST4, NT (NDST4, HSST4, Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4, Glucosaminyl N-deacetylase/N-sulfotransferase 4, N-heparan sulfate sulfotransferase 4, Heparan sulfate N-deacetylase 4, Heparan sulfate N-sulfotransferase 4) (APC) discontinued

Sign In for Pricing
View Details
Murine RNase Inhibitor
M0314L 15000 Units

Murine RNase Inhibitor

Sign In for Pricing
View Details
Lentiviral mouse Pcmtd1 shRNA (UAS) - Lentiviral mouse Pcmtd1 shRNA (UAS, GFP) (100)
GTR15231525 1 Vial

Lentiviral mouse Pcmtd1 shRNA (UAS) - Lentiviral mouse Pcmtd1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Inosine 5'-triphosphate trisodium salt
orb1221338-01 200 mg

Inosine 5'-triphosphate trisodium salt

Sign In for Pricing
View Details