Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OLFML2B Rabbit Polyclonal Antibody (Biotin)

OLFML2B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MGC51337, RP11-227F8.1

UniProt

Q68BL8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human OLFML2B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EEVSKNLTKENEQIKEDMEEIRTEMNKRGKENCSENILDSMPDIRSALQR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

84kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056256

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fatty Acid Binding Protein, Heart (Heart-type Fatty Acid-binding Protein, H-FABP, Fatty Acid Binding Protein 3, FABP3, FABP11, Mammary-derived Growth Inhibitor, MDGI, Muscle Fatty Acid Binding Protein, M-FABP, O-FABP) (PE)
F0019-76M-PE 100 µL

Fatty Acid Binding Protein, Heart (Heart-type Fatty Acid-binding Protein, H-FABP, Fatty Acid Binding Protein 3, FABP3, FABP11, Mammary-derived Growth Inhibitor, MDGI, Muscle Fatty Acid Binding Protein, M-FABP, O-FABP) (PE)

Sign In for Pricing
View Details
Mouse Protein S100-A9 ELISA Kit
MBS9427799-01 96 Tests

Mouse Protein S100-A9 ELISA Kit

Sign In for Pricing
View Details
Mouse Protein S100-A9 ELISA Kit
MBS9427799-02 5x 96 Tests

Mouse Protein S100-A9 ELISA Kit

Sign In for Pricing
View Details
NEUROD6 (Neurogenic Differentiation Factor 6, NeuroD6, Class A Basic Helix-loop-helix Protein 2, bHLHa2, Protein Atonal Homolog 2, ATOH2, BHLHA2, My051, MATH2, NEX1M) (MaxLight 650)
130307-ML650 100 µL

NEUROD6 (Neurogenic Differentiation Factor 6, NeuroD6, Class A Basic Helix-loop-helix Protein 2, bHLHa2, Protein Atonal Homolog 2, ATOH2, BHLHA2, My051, MATH2, NEX1M) (MaxLight 650)

Sign In for Pricing
View Details
Human Thymidine kinase, cytosolic ELISA Kit
MBS289056-01 48 Well

Human Thymidine kinase, cytosolic ELISA Kit

Sign In for Pricing
View Details
Human Thymidine kinase, cytosolic ELISA Kit
MBS289056-02 96 Well

Human Thymidine kinase, cytosolic ELISA Kit

Sign In for Pricing
View Details