Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OLFML2B Rabbit Polyclonal Antibody (FITC)

OLFML2B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MGC51337, RP11-227F8.1

UniProt

Q68BL8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human OLFML2B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EEVSKNLTKENEQIKEDMEEIRTEMNKRGKENCSENILDSMPDIRSALQR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

84kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056256

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUPL2, NT (NUPL2, CG1, Nucleoporin-like protein 2, NLP-1, NUP42 homolog, Nucleoporin hCG1) (MaxLight 405)
MBS6327320-01 0.1 mL

NUPL2, NT (NUPL2, CG1, Nucleoporin-like protein 2, NLP-1, NUP42 homolog, Nucleoporin hCG1) (MaxLight 405)

Sign In for Pricing
View Details
NUPL2, NT (NUPL2, CG1, Nucleoporin-like protein 2, NLP-1, NUP42 homolog, Nucleoporin hCG1) (MaxLight 405)
MBS6327320-02 5x 0.1 mL

NUPL2, NT (NUPL2, CG1, Nucleoporin-like protein 2, NLP-1, NUP42 homolog, Nucleoporin hCG1) (MaxLight 405)

Sign In for Pricing
View Details
TNFSF13B Rabbit Polyclonal Antibody
orb515065 100 µg

TNFSF13B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Kcnk5 shRNA (UAS) - Lentiviral mouse Kcnk5 shRNA (UAS, RFP) plasmid
GTR15273001 1 Vial

Lentiviral mouse Kcnk5 shRNA (UAS) - Lentiviral mouse Kcnk5 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
PCDNA3.1-3xHA-PELI1 (human) -T264A
BZ30788 1 Vial

PCDNA3.1-3xHA-PELI1 (human) -T264A

Sign In for Pricing
View Details
Anti-POT1 antibody
STJ95185 200 µl

Anti-POT1 antibody

Sign In for Pricing
View Details