Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKFZP564J0863 Rabbit Polyclonal Antibody (HRP)

DKFZP564J0863 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HSN1F

UniProt

Q6DD88

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DKFZP564J0863

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DHFKKTKKMGGKDFSFRYQQELEEEIKELYENFCKHNGSKNVFSTFRTPA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056274

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Receptor Activator Of Nuclear Factor Kappa B (RANk) ELISA Kit
RD-RANk-Hu-01 96 Tests

Human Receptor Activator Of Nuclear Factor Kappa B (RANk) ELISA Kit

Sign In for Pricing
View Details
Human Receptor Activator Of Nuclear Factor Kappa B (RANk) ELISA Kit
RD-RANk-Hu-02 48 Tests

Human Receptor Activator Of Nuclear Factor Kappa B (RANk) ELISA Kit

Sign In for Pricing
View Details
GFP Mouse Monoclonal Antibody [Clone ID: AT2G5]
AM09077PU-S 50 µL

GFP Mouse Monoclonal Antibody [Clone ID: AT2G5]

Sign In for Pricing
View Details
PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3496), CF740 conjugate, 0.1mg/mL
BNC743496-100 1x 100 µL

PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3496), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human GSTO2 activation kit by CRISPRa
GA114685 1 Kit

Human GSTO2 activation kit by CRISPRa

Sign In for Pricing
View Details
TIPRL Polyclonal Antibody
E-AB-18787-01 20 µL

TIPRL Polyclonal Antibody

Sign In for Pricing
View Details