Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCDHB5 Rabbit Polyclonal Antibody (HRP)

PCDHB5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PCDH-BETA5

UniProt

Q9Y5E4

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human PCDHB5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QFFQTDLQLTDINDHAPEFPEKEMLLKIPESTQPGTVFPLKIAQDFDIGS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

87kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_056484

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF165, ID (ZNF165, ZPF165, ZSCAN7, Zinc finger protein 165, Cancer/testis antigen 53, LD65, Zinc finger and SCAN domain-containing protein 7) (MaxLight 490)
MBS6365739-01 0.1 mL

ZNF165, ID (ZNF165, ZPF165, ZSCAN7, Zinc finger protein 165, Cancer/testis antigen 53, LD65, Zinc finger and SCAN domain-containing protein 7) (MaxLight 490)

Sign In for Pricing
View Details
ZNF165, ID (ZNF165, ZPF165, ZSCAN7, Zinc finger protein 165, Cancer/testis antigen 53, LD65, Zinc finger and SCAN domain-containing protein 7) (MaxLight 490)
MBS6365739-02 5x 0.1 mL

ZNF165, ID (ZNF165, ZPF165, ZSCAN7, Zinc finger protein 165, Cancer/testis antigen 53, LD65, Zinc finger and SCAN domain-containing protein 7) (MaxLight 490)

Sign In for Pricing
View Details
Anti-Atg2A Antibody
orb1148883 100 µg

Anti-Atg2A Antibody

Sign In for Pricing
View Details
RELA, Phosphorylated (S536) (NF-kappa-B, p65, NFKB3) (AP)
MBS6435417-01 0.1 mL

RELA, Phosphorylated (S536) (NF-kappa-B, p65, NFKB3) (AP)

Sign In for Pricing
View Details
RELA, Phosphorylated (S536) (NF-kappa-B, p65, NFKB3) (AP)
MBS6435417-02 5x 0.1 mL

RELA, Phosphorylated (S536) (NF-kappa-B, p65, NFKB3) (AP)

Sign In for Pricing
View Details
Urapidil HCl
S2025-10mM/1mL 10 mM/1mL

Urapidil HCl

Sign In for Pricing
View Details