Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOX3 Rabbit Polyclonal Antibody (FITC)

NOX3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MOX-2, GP91-3

UniProt

Q9HBY0

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence KQIAYNHPSSSIGVFFCGPKALSRTLQKMCHLYSSADPRGVHFYYNKESF

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KQIAYNHPSSSIGVFFCGPKALSRTLQKMCHLYSSADPRGVHFYYNKESF

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

65 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC

NCBI Accession Number

NP_056533

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNAP1 (non-SMC Condensin I Complex, Subunit D2, CAP-D2, CNAP1, KIAA0159, hCAP-D2) (MaxLight 750)
MBS6237711-01 0.1 mL

CNAP1 (non-SMC Condensin I Complex, Subunit D2, CAP-D2, CNAP1, KIAA0159, hCAP-D2) (MaxLight 750)

Sign In for Pricing
View Details
CNAP1 (non-SMC Condensin I Complex, Subunit D2, CAP-D2, CNAP1, KIAA0159, hCAP-D2) (MaxLight 750)
MBS6237711-02 5x 0.1 mL

CNAP1 (non-SMC Condensin I Complex, Subunit D2, CAP-D2, CNAP1, KIAA0159, hCAP-D2) (MaxLight 750)

Sign In for Pricing
View Details
NOL9 Peptide - N-terminal region
MBS3242886-01 0.1 mg

NOL9 Peptide - N-terminal region

Sign In for Pricing
View Details
NOL9 Peptide - N-terminal region
MBS3242886-02 5x 0.1 mg

NOL9 Peptide - N-terminal region

Sign In for Pricing
View Details
RAPD Kit (Random Amplified Polymorphic DNA), BioGenomicsTM, Kit-45
R1125-45 1 Kit

RAPD Kit (Random Amplified Polymorphic DNA), BioGenomicsTM, Kit-45

Sign In for Pricing
View Details
Anti-Centromere Protein Antibody - FITC Labeled
15-235-F 1 mL

Anti-Centromere Protein Antibody - FITC Labeled

Sign In for Pricing
View Details