Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Caly Rabbit Polyclonal Antibody (Biotin)

Caly Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Drd1ip, Calcyon

UniProt

P58821

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RHRSILAAIGAYPLSRKHGTEMPAIWGNSYRAGKEEHKGTTPAAMTVSTA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_620270

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAPPC2 3'UTR Luciferase Stable Cell Line
TU026287 1.0 mL

TRAPPC2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
UniPeak U+ One Step RT-qPCR SYBR Green Kit
Q226-00 100 Reactions

UniPeak U+ One Step RT-qPCR SYBR Green Kit

Sign In for Pricing
View Details
STAT1 (6C2)  monoclonal antibody
MB3049 50ul

STAT1 (6C2) monoclonal antibody

Sign In for Pricing
View Details
CD83 Recombinant Protein His Tag Lyophilized
MBS8430779-01 0.1 mg

CD83 Recombinant Protein His Tag Lyophilized

Sign In for Pricing
View Details
CD83 Recombinant Protein His Tag Lyophilized
MBS8430779-02 5x 0.1 mg

CD83 Recombinant Protein His Tag Lyophilized

Sign In for Pricing
View Details
Neurogenic locus notch homolog protein 2 (NOTCH2) Mouse ELISA Kit
F3332 96 Tests

Neurogenic locus notch homolog protein 2 (NOTCH2) Mouse ELISA Kit

Sign In for Pricing
View Details