Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Caly Rabbit Polyclonal Antibody (Biotin)

Caly Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Drd1ip, Calcyon

UniProt

P58821

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RHRSILAAIGAYPLSRKHGTEMPAIWGNSYRAGKEEHKGTTPAAMTVSTA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_620270

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ERBB2 qPCR Primer Pair
QH02629S 200 Tests

Human ERBB2 qPCR Primer Pair

Sign In for Pricing
View Details
Lentiviral mouse Megf8 shRNA (UAS) - Lentiviral mouse Megf8 shRNA (UAS, RFP) plasmid
GTR15287197 1 Vial

Lentiviral mouse Megf8 shRNA (UAS) - Lentiviral mouse Megf8 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
TipOne 200 uL natural pipette tips in racks, sterile, 10 racks of 96 tips (960 tips)
1111-0810 960 Tips

TipOne 200 uL natural pipette tips in racks, sterile, 10 racks of 96 tips (960 tips)

Sign In for Pricing
View Details
BPY2B 3'UTR Luciferase Stable Cell Line
TU001872 1.0 mL

BPY2B 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
HIST1H3A 3'UTR GFP Stable Cell Line
TU059840 1.0 mL

HIST1H3A 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Canine Glutathione peroxidase (GSH-Px) ELISA Kit
YP-W76401-01 48 Tests

Canine Glutathione peroxidase (GSH-Px) ELISA Kit

Sign In for Pricing
View Details