Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NSDHL Rabbit Polyclonal Antibody (HRP)

NSDHL Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

H105E3, XAP104, SDR31E1

UniProt

Q15738

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NSDHL

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RAVLGANDPEKNFLTTAIRPHGIFGPRDPQLVPILIEAARNGKMKFVIGN

Field of Research

Metabolism Research

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057006

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CYP2A6 (Cytochrome P450 2A6) ValidElisa Kit
EK341505 96 Well

Human CYP2A6 (Cytochrome P450 2A6) ValidElisa Kit

Sign In for Pricing
View Details
PLV3-U6-CTSD-shRNA1-Puro Plasmid
PVT76293 2 µg

PLV3-U6-CTSD-shRNA1-Puro Plasmid

Sign In for Pricing
View Details
Bovine Der1-like domain family, member 1 ELISA Kit
OM621771 96 Strip Well

Bovine Der1-like domain family, member 1 ELISA Kit

Sign In for Pricing
View Details
Nori® Porcine VEGFR3/FLT4 ELISA Kit
GR113148 96 Well

Nori® Porcine VEGFR3/FLT4 ELISA Kit

Sign In for Pricing
View Details
Lentiviral human TSEN15 shRNA (UAS) - Lentiviral human TSEN15 shRNA (UAS, iRFP) plasmid
GTR15342931 1 Vial

Lentiviral human TSEN15 shRNA (UAS) - Lentiviral human TSEN15 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
CACNA1G Protein Vector (Mouse) (pPM-C-His)
PV160821 500 ng

CACNA1G Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details