Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tmx2 Rabbit Polyclonal Antibody (HRP)

Tmx2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Txndc1, Txndc14, AA589631, 2310042M24Rik

UniProt

Q9D710

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Tmx2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: IRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKHSKGGDMSEEKPV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_080144

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELF3 Antibody
OAAL00090-100UG 100 µg

ELF3 Antibody

Sign In for Pricing
View Details
MIR106B Human qPCR Primer Pair (MI0000734)
HP300026 200 Reactions

MIR106B Human qPCR Primer Pair (MI0000734)

Sign In for Pricing
View Details
C51 Portable Meter+ SZ20T + carrying case
C51Z 1 Each

C51 Portable Meter+ SZ20T + carrying case

Sign In for Pricing
View Details
Recombinant Escherichia coli O157:H7 Endonuclease V (nfi)
MBS1069969-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O157:H7 Endonuclease V (nfi)

Sign In for Pricing
View Details
Recombinant Escherichia coli O157:H7 Endonuclease V (nfi)
MBS1069969-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O157:H7 Endonuclease V (nfi)

Sign In for Pricing
View Details
Recombinant Escherichia coli O157:H7 Endonuclease V (nfi)
MBS1069969-03 0.02 mg (Yeast)

Recombinant Escherichia coli O157:H7 Endonuclease V (nfi)

Sign In for Pricing
View Details