Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERGIC3 Rabbit Polyclonal Antibody (HRP)

ERGIC3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Erv46, CGI-54, C2orf47, PRO0989, C20orf47, NY-BR-84, SDBCAG84, dJ477O4.2

UniProt

Q9Y282

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ERGIC3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_057050

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (2-Hydroxyethyl) -3-methylimidazolium bis (trifluoromethylsulfonyl) imide
IL-0194-HP-0100 100 g

1- (2-Hydroxyethyl) -3-methylimidazolium bis (trifluoromethylsulfonyl) imide

Sign In for Pricing
View Details
Chicken Immunoglobulin G, IgG ELISA Kit
CK-bio-18160-01 48 Tests

Chicken Immunoglobulin G, IgG ELISA Kit

Sign In for Pricing
View Details
Chicken Immunoglobulin G, IgG ELISA Kit
CK-bio-18160-02 96 Tests

Chicken Immunoglobulin G, IgG ELISA Kit

Sign In for Pricing
View Details
Chicken Immunoglobulin G, IgG ELISA Kit
CK-bio-18160-03 5x 96 Tests

Chicken Immunoglobulin G, IgG ELISA Kit

Sign In for Pricing
View Details
Chicken Immunoglobulin G, IgG ELISA Kit
CK-bio-18160-04 10x 96 Tests

Chicken Immunoglobulin G, IgG ELISA Kit

Sign In for Pricing
View Details
ITGB6 (Integrin, beta 6, Integrin beta-6) (MaxLight 550)
128643-ML550 100 µL

ITGB6 (Integrin, beta 6, Integrin beta-6) (MaxLight 550)

Sign In for Pricing
View Details