Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dhrs7 Rabbit Polyclonal Antibody (FITC)

Dhrs7 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RetD, retS, Retdsr4, Retsdr4, AW061210, 2310016E22Rik, 5730564L20Rik

UniProt

Q9CXR1

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MVVWVTGASSGIGEELAFQLSKLGVSLVLSARRAQELERVKRRCLENGNL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_079798

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

A1-Antitrypsin (AAT, alpha-1-AT, alpha1 Proteinase Inhibitor, alpha1 PI) (PE) discontinued
A2298-30B-PE 100 µL

A1-Antitrypsin (AAT, alpha-1-AT, alpha1 Proteinase Inhibitor, alpha1 PI) (PE) discontinued

Sign In for Pricing
View Details
Lentiviral human HTR1A shRNA (UAS) - Lentiviral human HTR1A shRNA (UAS, iRFP) (100)
GTR15099975 1 Vial

Lentiviral human HTR1A shRNA (UAS) - Lentiviral human HTR1A shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Placental alkaline phosphatase (PLAP) Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-20015R-BF405-01 20 µL

Placental alkaline phosphatase (PLAP) Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Placental alkaline phosphatase (PLAP) Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-20015R-BF405-02 100 µL

Placental alkaline phosphatase (PLAP) Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Recombinant Human CEP192 Protein, N-His
orb3057553-01 50 µg

Recombinant Human CEP192 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CEP192 Protein, N-His
orb3057553-02 100 µg

Recombinant Human CEP192 Protein, N-His

Sign In for Pricing
View Details