Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hdhd2 Rabbit Polyclonal Antibody (FITC)

Hdhd2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ier3ip1, LRRG00122, RGD1308579

UniProt

Q6QI86

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Hdhd2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LMQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLLNLIR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001014173

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Filter Paper, Grade No. 44
2063759/3 1 Each

Filter Paper, Grade No. 44

Sign In for Pricing
View Details
TTBK2 Protein Vector (Human) (pPB-N-His)
PV044342 500 ng

TTBK2 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Bovine Wdfy Family Member 4 (WDFY4) ELISA Kit
MBS9919552-01 48 Well

Bovine Wdfy Family Member 4 (WDFY4) ELISA Kit

Sign In for Pricing
View Details
Bovine Wdfy Family Member 4 (WDFY4) ELISA Kit
MBS9919552-02 96 Well

Bovine Wdfy Family Member 4 (WDFY4) ELISA Kit

Sign In for Pricing
View Details
Bovine Wdfy Family Member 4 (WDFY4) ELISA Kit
MBS9919552-03 5x 96 Well

Bovine Wdfy Family Member 4 (WDFY4) ELISA Kit

Sign In for Pricing
View Details
Bovine Wdfy Family Member 4 (WDFY4) ELISA Kit
MBS9919552-04 10x 96 Well

Bovine Wdfy Family Member 4 (WDFY4) ELISA Kit

Sign In for Pricing
View Details