Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C19orf56 Rabbit Polyclonal Antibody (HRP)

C19orf56 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PAT10, PAT-10, PTD008, ASTERIX, C19orf56

UniProt

Q9Y284

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C19orf56

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: STNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLML

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057229

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PUM2 shRNA (UAS) - Lentiviral human PUM2 shRNA (UAS, GFP) (100)
GTR15352896 1 Vial

Lentiviral human PUM2 shRNA (UAS) - Lentiviral human PUM2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Rabbit Polyclonal DDX21 Antibody [Janelia Fluor 549]
NB100-1718JF549 0.1 mL

Rabbit Polyclonal DDX21 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
Tekt1 ORF Vector (Rat) (pORF)
ORF077585 1.0 µg DNA

Tekt1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
ZN37A rabbit pAb
MBS8597618-01 0.1 mL

ZN37A rabbit pAb

Sign In for Pricing
View Details
ZN37A rabbit pAb
MBS8597618-02 0.1 mL (AF405L)

ZN37A rabbit pAb

Sign In for Pricing
View Details
ZN37A rabbit pAb
MBS8597618-03 0.1 mL (AF405S)

ZN37A rabbit pAb

Sign In for Pricing
View Details