Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C19orf56 Rabbit Polyclonal Antibody (HRP)

C19orf56 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PAT10, PAT-10, PTD008, ASTERIX, C19orf56

UniProt

Q9Y284

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C19orf56

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: STNNMSDPRRPNKVLRYKPPPSECNPALDDPTPDYMNLLGMIFSMCGLML

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057229

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal KLHL34 Antibody [DyLight 755]
NBP2-98044IR 0.1 mL

Rabbit Polyclonal KLHL34 Antibody [DyLight 755]

Sign In for Pricing
View Details
YcgN Antibody
orb831743 2 mg

YcgN Antibody

Sign In for Pricing
View Details
LAMP2 Antibody (RPE)
orb147250 100 µg

LAMP2 Antibody (RPE)

Sign In for Pricing
View Details
Goat Nitric oxide synthase, inducible, NOS2 ELISA Kit
MBS9330547 Inquire

Goat Nitric oxide synthase, inducible, NOS2 ELISA Kit

Sign In for Pricing
View Details
Anti-Fundulus heteroclitus (Killifish) Serine/threonine-protein kinase Antibody APC Conjugated
DZ41662-APC 200 µL/Vial

Anti-Fundulus heteroclitus (Killifish) Serine/threonine-protein kinase Antibody APC Conjugated

Sign In for Pricing
View Details
Phospho-Nrf2 (Ser40) Recombinant Rabbit mAb, BF350 conjugated
orb1587918 100 µL

Phospho-Nrf2 (Ser40) Recombinant Rabbit mAb, BF350 conjugated

Sign In for Pricing
View Details