Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A4GNT Rabbit Polyclonal Antibody (HRP)

A4GNT Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Alpha4GnT

UniProt

Q9UNA3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human A4GNT

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NISFLHPQRFYPISYREWRRYYEVWDTEPSFNVSYALHLWNHMNQEGRAV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057245

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Cytoplasmic immunoglobulin (Cig) ELISA Kit
NSL0953Ch 96 Tests

Chicken Cytoplasmic immunoglobulin (Cig) ELISA Kit

Sign In for Pricing
View Details
Goat Hippocalcin like protein 1 (HPCAL1) ELISA kit
GTR10411632 96 Well

Goat Hippocalcin like protein 1 (HPCAL1) ELISA kit

Sign In for Pricing
View Details
LSP1 Rabbit mAb
E60M1656 100 µL

LSP1 Rabbit mAb

Sign In for Pricing
View Details
Human Vascular cell adhesion molecule 1, VCAM-1 ELISA kit
CK-bio-13932-01 48 Tests

Human Vascular cell adhesion molecule 1, VCAM-1 ELISA kit

Sign In for Pricing
View Details
Human Vascular cell adhesion molecule 1, VCAM-1 ELISA kit
CK-bio-13932-02 96 Tests

Human Vascular cell adhesion molecule 1, VCAM-1 ELISA kit

Sign In for Pricing
View Details
Human Vascular cell adhesion molecule 1, VCAM-1 ELISA kit
CK-bio-13932-03 5x 96 Tests

Human Vascular cell adhesion molecule 1, VCAM-1 ELISA kit

Sign In for Pricing
View Details