Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SDF4 Rabbit Polyclonal Antibody (HRP)

SDF4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Cab45, SDF-4

UniProt

B1AME6

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SDF4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KQLSVPEFISLPVGTVENQQGQDIDDNWVKDRKKEFEELIDSNHDGIVTA

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057631

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APOD Immunizing Peptide
orb737723 100 µg

APOD Immunizing Peptide

Sign In for Pricing
View Details
SLC9A6 (Sodium/hydrogen Exchanger 6, Na (+) /H (+) Exchanger 6, NHE-6, Solute Carrier Family 9 Member 6, KIAA0267, NHE6) discontinued
225877-01 50 µL

SLC9A6 (Sodium/hydrogen Exchanger 6, Na (+) /H (+) Exchanger 6, NHE-6, Solute Carrier Family 9 Member 6, KIAA0267, NHE6) discontinued

Sign In for Pricing
View Details
SLC9A6 (Sodium/hydrogen Exchanger 6, Na (+) /H (+) Exchanger 6, NHE-6, Solute Carrier Family 9 Member 6, KIAA0267, NHE6) discontinued
225877-02 100 µL

SLC9A6 (Sodium/hydrogen Exchanger 6, Na (+) /H (+) Exchanger 6, NHE-6, Solute Carrier Family 9 Member 6, KIAA0267, NHE6) discontinued

Sign In for Pricing
View Details
N-Ethyl-N-nitrosourea
orb2814165 200 mg

N-Ethyl-N-nitrosourea

Sign In for Pricing
View Details
Guanylyl Cyclase alpha 1 (GUCY1A3) Antibody (N-term) Blocking peptide
MBS9226612-01 0.5 mg

Guanylyl Cyclase alpha 1 (GUCY1A3) Antibody (N-term) Blocking peptide

Sign In for Pricing
View Details
Guanylyl Cyclase alpha 1 (GUCY1A3) Antibody (N-term) Blocking peptide
MBS9226612-02 5x 0.5 mg

Guanylyl Cyclase alpha 1 (GUCY1A3) Antibody (N-term) Blocking peptide

Sign In for Pricing
View Details