Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEFF2 Rabbit Polyclonal Antibody (Biotin)

TMEFF2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

TR, HPP1, TPEF, TR-2, TENB2, CT120.2

UniProt

Q9UIK5

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human TMEFF2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

StARD9 CRISPR/Cas9 KO Plasmid (h)
sc-407328 20 µg

StARD9 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Lpin3 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4121404 1.0 µg DNA

Lpin3 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
BLM Rabbit pAb
orb2711740-01 50 µL

BLM Rabbit pAb

Sign In for Pricing
View Details
BLM Rabbit pAb
orb2711740-02 100 µL

BLM Rabbit pAb

Sign In for Pricing
View Details
Chicken Olfactory receptor 2W3 (OR2W3) ELISA kit
GTR10402730 96 Well

Chicken Olfactory receptor 2W3 (OR2W3) ELISA kit

Sign In for Pricing
View Details
Beta catenin Rabbit pAb, BF700 conjugated
orb2848975 100 µL

Beta catenin Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details