Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL1RL1 Rabbit Polyclonal Antibody (HRP)

IL1RL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

T1, ST2, DER4, ST2L, ST2V, FIT-1, IL33R

UniProt

Q01638

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human IL1RL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTC

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse

Tested Applications

WB

NCBI Accession Number

NP_057316

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEC61G (NM_001012456) Human Over-expression Lysate
LC422868 20 µg

SEC61G (NM_001012456) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Robo1 activation kit by CRISPRa
GA203667 1 Kit

Mouse Robo1 activation kit by CRISPRa

Sign In for Pricing
View Details
WDR34 (Center) Rabbit Polyclonal Antibody
AP54540PU-N 400 µL

WDR34 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Blocks, Colon: right
CB526413 1 Block

Frozen Tissue Blocks, Colon: right

Sign In for Pricing
View Details
VISTA / GI24 (Negative Regulator of Immune Response) (VISTA/3006), CF640R conjugate, 0.1mg/mL
BNC403006-100 1x 100 µL

VISTA / GI24 (Negative Regulator of Immune Response) (VISTA/3006), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS638428 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details