Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Scara3 Rabbit Polyclonal Antibody (FITC)

Scara3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CSR, APC7, CSR1, MSLR1, MSRL1, C130058N24Rik

UniProt

Q8C850

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KTIQTTLGASSQRISQNSESMHDLVLQVMGLQLQLDNISSFLDDHEENMH

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_766192

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXD4L4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0796007 1.0 µg DNA

FOXD4L4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
TXA2R Rabbit Polyclonal Antibody (FITC)
orb190584 100 µL

TXA2R Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
H-α-cyclopropyl-Ala-OH · HCl
4101678.0001 1 g

H-α-cyclopropyl-Ala-OH · HCl

Sign In for Pricing
View Details
Lentiviral mouse H4c8 shRNA (UAS) - Lentiviral mouse H4c8 shRNA (UAS) (25)
GTR15181853 1 Vial

Lentiviral mouse H4c8 shRNA (UAS) - Lentiviral mouse H4c8 shRNA (UAS) (25)

Sign In for Pricing
View Details
HGS Rabbit Polyclonal Antibody (BF555)
orb2505762 100 µL

HGS Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
KPNA5 (Importin Subunit alpha-6, Karyopherin Subunit alpha-5) (AP)
MBS6132031-01 0.1 mL

KPNA5 (Importin Subunit alpha-6, Karyopherin Subunit alpha-5) (AP)

Sign In for Pricing
View Details