Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyb5r1 Rabbit Polyclonal Antibody (FITC)

Cyb5r1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Nqo, B5R., B5R.1, C80155, Nqo3a2, 1500005G05Rik

UniProt

Q9DB73

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKIGD

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_082333

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CFH Antibody
CAC10686-01 50 µL

CFH Antibody

Sign In for Pricing
View Details
CFH Antibody
CAC10686-02 100 µL

CFH Antibody

Sign In for Pricing
View Details
NOTCH2, CT (Notch 2, Notch 2 homolog, Notch homolog 2, Notch homolog-2) (MaxLight 490)
MBS6453033-01 0.1 mL

NOTCH2, CT (Notch 2, Notch 2 homolog, Notch homolog 2, Notch homolog-2) (MaxLight 490)

Sign In for Pricing
View Details
NOTCH2, CT (Notch 2, Notch 2 homolog, Notch homolog 2, Notch homolog-2) (MaxLight 490)
MBS6453033-02 5x 0.1 mL

NOTCH2, CT (Notch 2, Notch 2 homolog, Notch homolog 2, Notch homolog-2) (MaxLight 490)

Sign In for Pricing
View Details
Oxybutynin hydrochloride
S3117-50mg 50 mg

Oxybutynin hydrochloride

Sign In for Pricing
View Details
N- (5-bromo-2-methoxyphenyl) pivalamide
OR1095400-01 1 g

N- (5-bromo-2-methoxyphenyl) pivalamide

Sign In for Pricing
View Details