Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cyb5r1 Rabbit Polyclonal Antibody (HRP)

Cyb5r1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Nqo, B5R., B5R.1, C80155, Nqo3a2, 1500005G05Rik

UniProt

Q9DB73

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKIGD

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_082333

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ankrd52 Mouse Gene Knockout Kit (CRISPR)
KN501297 1 Kit

Ankrd52 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human RASL11A activation kit by CRISPRa
GA117887 1 Kit

Human RASL11A activation kit by CRISPRa

Sign In for Pricing
View Details
MIR4540 Human qPCR Primer Pair (MI0016911)
HP301028 200 Reactions

MIR4540 Human qPCR Primer Pair (MI0016911)

Sign In for Pricing
View Details
CEBPD Rabbit Polyclonal Antibody
TA374615 100 µL

CEBPD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AHA1 (AHSA1) Rabbit Polyclonal Antibody
AP06790PU-N 100 µg

AHA1 (AHSA1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TAS2R14 Rabbit Polyclonal Antibody
TA361668 100 µL

TAS2R14 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details