Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAJB11 Rabbit Polyclonal Antibody (Biotin)

DNAJB11 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DJ9, EDJ, Dj-9, ERj3, PKD6, ABBP2, ERdj3, ERj3p, ABBP-2, UNQ537, PRO1080

UniProt

Q9UBS4

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DNAJB11

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FDNNNIKGSLIITFDVDFPKEQLTEEAREGIKQLLKQGSVQKVYNGLQGY

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057390

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCNXL2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1612507 1.0 µg DNA

PCNXL2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
NHLH2 Antibody - N-terminal : Biotin (ARP74999_P050-Biotin)
ARP74999_P050-Biotin 100 µL

NHLH2 Antibody - N-terminal : Biotin (ARP74999_P050-Biotin)

Sign In for Pricing
View Details
IFI6 Antibody
A48982-100UL 100 µL

IFI6 Antibody

Sign In for Pricing
View Details
Recombinant Human DFFA Protein, His Tag
KMH984-01 100 µg

Recombinant Human DFFA Protein, His Tag

Sign In for Pricing
View Details
Recombinant Human DFFA Protein, His Tag
KMH984-02 50 µg

Recombinant Human DFFA Protein, His Tag

Sign In for Pricing
View Details
Mouse alkaline phosphatase (ALP) ELISA Kit
GA-E0212MS-01 48 Tests

Mouse alkaline phosphatase (ALP) ELISA Kit

Sign In for Pricing
View Details