Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lipocalin-2/NGAL, Human (HEK293, His)

Lipocalin-2/NGAL is an iron transporter that plays a crucial role in various cellular processes. It interacts with the siderophore 2,3-DHBA to transport iron into or out of cells depending on cellular needs. Lipocalin-2/NGAL Protein, Human (HEK293, His) is the recombinant human-derived Lipocalin-2/NGAL protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Lipocalin-2/NGAL Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lipocalin-2-ngal-protein-human-hek-293-his.html

Purity

98.50

Smiles

QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG

Molecular Formula

3934 (Gene_ID) P80188-1 (Q21-G198) (Accession)

Molecular Weight

Approximately 21-24 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Albumin, Bovine Serum (BSA) (Glycerol Free) (MaxLight 405) discontinued
A1275-04A-ML405 100 µL

Albumin, Bovine Serum (BSA) (Glycerol Free) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Thioredoxin (TRDX, Trx, TRX1, TXN, ATL-derived Factor, ADF, Surface-associated Sulphydryl Protein, SASP) (MaxLight 490)
MBS6397683-01 0.1 mL

Thioredoxin (TRDX, Trx, TRX1, TXN, ATL-derived Factor, ADF, Surface-associated Sulphydryl Protein, SASP) (MaxLight 490)

Sign In for Pricing
View Details
Thioredoxin (TRDX, Trx, TRX1, TXN, ATL-derived Factor, ADF, Surface-associated Sulphydryl Protein, SASP) (MaxLight 490)
MBS6397683-02 5x 0.1 mL

Thioredoxin (TRDX, Trx, TRX1, TXN, ATL-derived Factor, ADF, Surface-associated Sulphydryl Protein, SASP) (MaxLight 490)

Sign In for Pricing
View Details
FASTK sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0758705 3x 1.0 µg

FASTK sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Mterf 3'UTR Luciferase Stable Cell Line
TU113564 1.0 mL

Mterf 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
AP-180 siRNA (m)
sc-29699 10 µM

AP-180 siRNA (m)

Sign In for Pricing
View Details