Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clec1b Rabbit Polyclonal Antibody (HRP)

Clec1b Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Clec, Clec-, Clec2, Clec-2, 1810061I13Rik

UniProt

Q9JL99

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MQDEDGYITLNIKPRKQALSSAEPASSWWRVMALVLLISSMGLVVGLVAL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_064369

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PetriStickers 32-Square Grid Type
1217207 36 PK

PetriStickers 32-Square Grid Type

Sign In for Pricing
View Details
SCOC Recombinant Protein (Mouse)
RP170342 100 µg

SCOC Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Recombinant Mycobacterium vanbaalenii Glycine--tRNA ligase (glyQS)
MBS1245583-01 0.02 mg (E-Coli)

Recombinant Mycobacterium vanbaalenii Glycine--tRNA ligase (glyQS)

Sign In for Pricing
View Details
Recombinant Mycobacterium vanbaalenii Glycine--tRNA ligase (glyQS)
MBS1245583-02 0.02 mg (Yeast)

Recombinant Mycobacterium vanbaalenii Glycine--tRNA ligase (glyQS)

Sign In for Pricing
View Details
Recombinant Mycobacterium vanbaalenii Glycine--tRNA ligase (glyQS)
MBS1245583-03 0.1 mg (E-Coli)

Recombinant Mycobacterium vanbaalenii Glycine--tRNA ligase (glyQS)

Sign In for Pricing
View Details
Recombinant Mycobacterium vanbaalenii Glycine--tRNA ligase (glyQS)
MBS1245583-04 0.1 mg (Yeast)

Recombinant Mycobacterium vanbaalenii Glycine--tRNA ligase (glyQS)

Sign In for Pricing
View Details