Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GOLM1 Rabbit Polyclonal Antibody (Biotin)

GOLM1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GP73, HEL46, GOLPH2, C9orf155, PSEC0257, bA379P1.3

UniProt

Q8NBJ4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GOLM1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057632

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFkB p100 / p52 (NFKB2) Rabbit Polyclonal Antibody
AP06241PU-N 100 µg

NFkB p100 / p52 (NFKB2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human ARHGAP17 activation kit by CRISPRa
GA110526 1 Kit

Human ARHGAP17 activation kit by CRISPRa

Sign In for Pricing
View Details
Cardiac Troponin T (TNNT2) Mouse Monoclonal Antibody [Clone ID: OTI8B5]
CF807959 100 µg

Cardiac Troponin T (TNNT2) Mouse Monoclonal Antibody [Clone ID: OTI8B5]

Sign In for Pricing
View Details
Recombinant Human PDGF-AA Protein (His Tag)
PKSH032905-01 10 µg

Recombinant Human PDGF-AA Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human PDGF-AA Protein (His Tag)
PKSH032905-02 50 µg

Recombinant Human PDGF-AA Protein (His Tag)

Sign In for Pricing
View Details
Tmem159 (NM_145586) Mouse Tagged ORF Clone
MG201254 10 µg

Tmem159 (NM_145586) Mouse Tagged ORF Clone

Sign In for Pricing
View Details