Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GOLM1 Rabbit Polyclonal Antibody (HRP)

GOLM1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GP73, HEL46, GOLPH2, C9orf155, PSEC0257, bA379P1.3

UniProt

Q8NBJ4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GOLM1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057632

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Tmsb15b2 activation kit by CRISPRa
GA218719 1 Kit

Mouse Tmsb15b2 activation kit by CRISPRa

Sign In for Pricing
View Details
Rat Cadherin 5 (CDH5) ELISA Kit
JL41784-01 48 Tests

Rat Cadherin 5 (CDH5) ELISA Kit

Sign In for Pricing
View Details
Rat Cadherin 5 (CDH5) ELISA Kit
JL41784-02 96 Tests

Rat Cadherin 5 (CDH5) ELISA Kit

Sign In for Pricing
View Details
PARP 1, cleaved (Asp214) (Poly ADP-Ribose Polymerase 1, Poly [ADP-ribose] Polymerase 1, PARP1, PARP-1, PARP, ADPRT 1, ADPRT1, ADPRT, NAD (+) ADP-ribosyltransferase 1, pADPRT-1, Poly[ADP-ribose] Synthase 1, PPOL)
P3113-22-01 20 µL

PARP 1, cleaved (Asp214) (Poly ADP-Ribose Polymerase 1, Poly [ADP-ribose] Polymerase 1, PARP1, PARP-1, PARP, ADPRT 1, ADPRT1, ADPRT, NAD (+) ADP-ribosyltransferase 1, pADPRT-1, Poly[ADP-ribose] Synthase 1, PPOL)

Sign In for Pricing
View Details
PARP 1, cleaved (Asp214) (Poly ADP-Ribose Polymerase 1, Poly [ADP-ribose] Polymerase 1, PARP1, PARP-1, PARP, ADPRT 1, ADPRT1, ADPRT, NAD (+) ADP-ribosyltransferase 1, pADPRT-1, Poly[ADP-ribose] Synthase 1, PPOL)
P3113-22-02 100 µL

PARP 1, cleaved (Asp214) (Poly ADP-Ribose Polymerase 1, Poly [ADP-ribose] Polymerase 1, PARP1, PARP-1, PARP, ADPRT 1, ADPRT1, ADPRT, NAD (+) ADP-ribosyltransferase 1, pADPRT-1, Poly[ADP-ribose] Synthase 1, PPOL)

Sign In for Pricing
View Details
EMILIN3 AAV siRNA Pooled Vector
19259161 1.0 µg

EMILIN3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details