Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCDH12 Rabbit Polyclonal Antibody (Biotin)

PCDH12 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DMJDS1, VECAD2, VE-cadherin-2

UniProt

Q9NPG4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PCDH12

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SSRPFLLTTIVARDADSGANGEPLYSIRSGNEAHLFILNPHTGQLFVNVT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

126kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_057664

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Gab1 shRNA (UAS) - Lentiviral mouse Gab1 shRNA (UAS) plasmid
GTR15164083 1 Vial

Lentiviral mouse Gab1 shRNA (UAS) - Lentiviral mouse Gab1 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Chicken HSPB1 (Heat Shock 27kDa Protein 1) ELISA Kit
MBS8820353-01 48 Well

Chicken HSPB1 (Heat Shock 27kDa Protein 1) ELISA Kit

Sign In for Pricing
View Details
Chicken HSPB1 (Heat Shock 27kDa Protein 1) ELISA Kit
MBS8820353-02 96 Well

Chicken HSPB1 (Heat Shock 27kDa Protein 1) ELISA Kit

Sign In for Pricing
View Details
Chicken HSPB1 (Heat Shock 27kDa Protein 1) ELISA Kit
MBS8820353-03 5x 96 Well

Chicken HSPB1 (Heat Shock 27kDa Protein 1) ELISA Kit

Sign In for Pricing
View Details
Chicken HSPB1 (Heat Shock 27kDa Protein 1) ELISA Kit
MBS8820353-04 10x 96 Well

Chicken HSPB1 (Heat Shock 27kDa Protein 1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Transmembrane protein 141
MBS969624-01 0.02 mg (E-Coli)

Recombinant Human Transmembrane protein 141

Sign In for Pricing
View Details