Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCDH12 Rabbit Polyclonal Antibody (FITC)

PCDH12 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DMJDS1, VECAD2, VE-cadherin-2

UniProt

Q9NPG4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PCDH12

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SSRPFLLTTIVARDADSGANGEPLYSIRSGNEAHLFILNPHTGQLFVNVT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

126kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_057664

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PerfectMembrane-Mini Square, PVDF, 0.45um, 100 sheets
B321-100 100 Membranes

PerfectMembrane-Mini Square, PVDF, 0.45um, 100 sheets

Sign In for Pricing
View Details
POLA2 (DNA Polymerase alpha Subunit B, DNA Polymerase alpha 70kD Subunit) (MaxLight 550)
MBS6213252-01 0.1 mL

POLA2 (DNA Polymerase alpha Subunit B, DNA Polymerase alpha 70kD Subunit) (MaxLight 550)

Sign In for Pricing
View Details
POLA2 (DNA Polymerase alpha Subunit B, DNA Polymerase alpha 70kD Subunit) (MaxLight 550)
MBS6213252-02 5x 0.1 mL

POLA2 (DNA Polymerase alpha Subunit B, DNA Polymerase alpha 70kD Subunit) (MaxLight 550)

Sign In for Pricing
View Details
(4-Fluoropyridin-2-yl) methanamine dihydrochloride
HAC53513-01 50 mg

(4-Fluoropyridin-2-yl) methanamine dihydrochloride

Sign In for Pricing
View Details
(4-Fluoropyridin-2-yl) methanamine dihydrochloride
HAC53513-02 0.5 g

(4-Fluoropyridin-2-yl) methanamine dihydrochloride

Sign In for Pricing
View Details
MMP8 Antibody, Biotin conjugated
MBS7049499-01 0.05 mg

MMP8 Antibody, Biotin conjugated

Sign In for Pricing
View Details