Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCNT4 Rabbit Polyclonal Antibody (FITC)

GCNT4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C2GNT3, LINC01336

UniProt

Q9P109

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human GCNT4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SKDTYSPDEHFWATLIRVPGIPGEISRSAQDVSDLQSKTRLVKWNYYEGF

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057675

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGFalpha (P/T1), CF405S conjugate, 0.1mg/mL
BNC040787-500 1x 500 µL

TGFalpha (P/T1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FABP2 (Marker of Metastatic Potential in Colorectal Cancer) (CPTC-FABP2-3), CF647 conjugate, 0.1mg/mL
BNC472226-500 1x 500 µL

FABP2 (Marker of Metastatic Potential in Colorectal Cancer) (CPTC-FABP2-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TmLhe Mouse Gene Knockout Kit (CRISPR)
KN517924 1 Kit

TmLhe Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse CD45.1 Antibody[A20]
E-AB-F1184Q-01 50 Tests

Elab Fluor® Violet 450 Anti-Mouse CD45.1 Antibody[A20]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse CD45.1 Antibody[A20]
E-AB-F1184Q-02 100 Tests

Elab Fluor® Violet 450 Anti-Mouse CD45.1 Antibody[A20]

Sign In for Pricing
View Details
Elab Fluor® Violet 450 Anti-Mouse CD45.1 Antibody[A20]
E-AB-F1184Q-03 2x 100 Tests

Elab Fluor® Violet 450 Anti-Mouse CD45.1 Antibody[A20]

Sign In for Pricing
View Details