Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCNT4 Rabbit Polyclonal Antibody (HRP)

GCNT4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C2GNT3, LINC01336

UniProt

Q9P109

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human GCNT4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SKDTYSPDEHFWATLIRVPGIPGEISRSAQDVSDLQSKTRLVKWNYYEGF

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057675

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC15 Recombinant Rabbit mAb
E43S45355 100 µL

LRRC15 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Human SEPT3/Neuronal-specific septin-3 ELISA Kit
E2244Hu 96 Tests

Human SEPT3/Neuronal-specific septin-3 ELISA Kit

Sign In for Pricing
View Details
Guinea pig Anti-Ovarian Antibody (AOAb) ELISA Kit
EIA05298Gu 1 Kit

Guinea pig Anti-Ovarian Antibody (AOAb) ELISA Kit

Sign In for Pricing
View Details
C2CD4D Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-15144R-BF405 100 µL

C2CD4D Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Foxd2 shRNA (UAS) - Lentiviral mouse Foxd2 shRNA (UAS) plasmid
GTR15105187 1 Vial

Lentiviral mouse Foxd2 shRNA (UAS) - Lentiviral mouse Foxd2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
PUSL1 (NM_153339) Human Over-expression Lysate
LH14872V 100 µg

PUSL1 (NM_153339) Human Over-expression Lysate

Sign In for Pricing
View Details