Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARMCX3 Rabbit Polyclonal Antibody (Biotin)

ARMCX3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ALEX3, GASP6, dJ545K15.2

UniProt

Q9UH62

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ARMCX3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057691

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR36 (WD Repeat-containing Protein 36, T-cell Activation WD Repeat-containing Protein, TAWDRP, TA-WDRP, GLC1G, UTP21) (PE)
135346-PE 100 µL

WDR36 (WD Repeat-containing Protein 36, T-cell Activation WD Repeat-containing Protein, TAWDRP, TA-WDRP, GLC1G, UTP21) (PE)

Sign In for Pricing
View Details
FBXO46 shRNA (m) Lentiviral Particles
sc-145130-V 200 µL

FBXO46 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Mouse Monoclonal HLA G Antibody (MEM-G/4) [Allophycocyanin/Cy7]
NB500-533APCCY7 0.1 mL

Mouse Monoclonal HLA G Antibody (MEM-G/4) [Allophycocyanin/Cy7]

Sign In for Pricing
View Details
Gas7 Mouse siRNA Oligo Duplex (Locus ID 14457)
SR413977 1 Kit

Gas7 Mouse siRNA Oligo Duplex (Locus ID 14457)

Sign In for Pricing
View Details
APC/CY7-Linked Monoclonal Antibody to Interleukin 8 (IL8)
MBS2037182-01 0.1 mL

APC/CY7-Linked Monoclonal Antibody to Interleukin 8 (IL8)

Sign In for Pricing
View Details
APC/CY7-Linked Monoclonal Antibody to Interleukin 8 (IL8)
MBS2037182-02 0.2 mL

APC/CY7-Linked Monoclonal Antibody to Interleukin 8 (IL8)

Sign In for Pricing
View Details