Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Armcx1 Rabbit Polyclonal Antibody (Biotin)

Armcx1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ALEX1, 3010033I09Rik

UniProt

Q9CX83

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LDSAVQMAGLRLLTNMTVTNHYQHLLSYSFPDFFALLFLGNHFTKIQTMK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_084342

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

c-Kit/N705AStable Ba/F3 Cell Line
T3049 1x106 cells / 1.0 mL

c-Kit/N705AStable Ba/F3 Cell Line

Sign In for Pricing
View Details
Lentiviral mouse Dtx3 shRNA (UAS) - Lentiviral mouseDtx3 shRNA (UAS, GFP) (25)
GTR15249224 1 Vial

Lentiviral mouse Dtx3 shRNA (UAS) - Lentiviral mouseDtx3 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Cowingene Dengue Virus, Zika Virus and Chikungunya Virus Detection Kit
FE01022R 96 Tests/Kit

Cowingene Dengue Virus, Zika Virus and Chikungunya Virus Detection Kit

Sign In for Pricing
View Details
CHRM2, ID (CHRM2, Muscarinic acetylcholine receptor M2) (MaxLight 750) discontinued
033867-ML750 100 µL

CHRM2, ID (CHRM2, Muscarinic acetylcholine receptor M2) (MaxLight 750) discontinued

Sign In for Pricing
View Details
PRL1 Antibody
orb1428006-01 50 µL

PRL1 Antibody

Sign In for Pricing
View Details
PRL1 Antibody
orb1428006-02 100 µL

PRL1 Antibody

Sign In for Pricing
View Details