Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDE1 Rabbit Polyclonal Antibody (HRP)

GDE1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MIR16, 363E6.2

UniProt

Q9NZC3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GDE1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LRVFSFEPVPSCRALQVLKPRDRISAIAHRGGSHDAPENTLAAIRQAAKN

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_057725

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Btbd6 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7510003 1.0 µg DNA

Btbd6 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
TRIM27 sgRNA CRISPR Lentivector (Human) (Target 2)
K2465303 1.0 µg DNA

TRIM27 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Factor VII (Serum prothrombin conversion accelerator, Coagulation factor VII, SPCA, Proconvertin, F7) discontinued
F0015-01D 50 µL

Factor VII (Serum prothrombin conversion accelerator, Coagulation factor VII, SPCA, Proconvertin, F7) discontinued

Sign In for Pricing
View Details
MED30, ID (MED30, THRAP6, TRAP25, Mediator of RNA polymerase II transcription subunit 30, Mediator complex subunit 30, TRAP/Mediator complex component TRAP25, Thyroid hormone receptor-associated protein 6, Thyroid hormone receptor-associated protein compl
MBS6320028-01 0.1 mL

MED30, ID (MED30, THRAP6, TRAP25, Mediator of RNA polymerase II transcription subunit 30, Mediator complex subunit 30, TRAP/Mediator complex component TRAP25, Thyroid hormone receptor-associated protein 6, Thyroid hormone receptor-associated protein compl

Sign In for Pricing
View Details
MED30, ID (MED30, THRAP6, TRAP25, Mediator of RNA polymerase II transcription subunit 30, Mediator complex subunit 30, TRAP/Mediator complex component TRAP25, Thyroid hormone receptor-associated protein 6, Thyroid hormone receptor-associated protein compl
MBS6320028-02 5x 0.1 mL

MED30, ID (MED30, THRAP6, TRAP25, Mediator of RNA polymerase II transcription subunit 30, Mediator complex subunit 30, TRAP/Mediator complex component TRAP25, Thyroid hormone receptor-associated protein 6, Thyroid hormone receptor-associated protein compl

Sign In for Pricing
View Details
Prednisolon HRP Conjugate
B2021281 1 mg

Prednisolon HRP Conjugate

Sign In for Pricing
View Details