Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Them6 Rabbit Polyclonal Antibody (Biotin)

Them6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

4930572J05Rik

UniProt

Q80ZW2

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse 4930572J05Rik

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RRSLRLFEPFEVHTRLQGWDDRAFYLEARFVSLRDGFVCALLRFRQHVLG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_941009

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF4B, ID (Eukaryotic Initiation Factor 4B, Eukaryotic Translation Initiation Factor 4B, hCG_2014609, eIF4B) (PE)
MBS6475274-01 0.2 mL

EIF4B, ID (Eukaryotic Initiation Factor 4B, Eukaryotic Translation Initiation Factor 4B, hCG_2014609, eIF4B) (PE)

Sign In for Pricing
View Details
EIF4B, ID (Eukaryotic Initiation Factor 4B, Eukaryotic Translation Initiation Factor 4B, hCG_2014609, eIF4B) (PE)
MBS6475274-02 5x 0.2 mL

EIF4B, ID (Eukaryotic Initiation Factor 4B, Eukaryotic Translation Initiation Factor 4B, hCG_2014609, eIF4B) (PE)

Sign In for Pricing
View Details
Goat anti-Rabbit IgG Heavy and Light Chain Antibody Affinity Purified
A120-101A 1 mg

Goat anti-Rabbit IgG Heavy and Light Chain Antibody Affinity Purified

Sign In for Pricing
View Details
ZDHHC23 Rabbit Polyclonal Antibody (BF680)
orb2479869 100 µL

ZDHHC23 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Lentiviral human GATA3 sgRNA gene knockout kit - Lentiviral human GATA3 sgRNA gene knockout kit (100)
GTR15374278 1 Vial

Lentiviral human GATA3 sgRNA gene knockout kit - Lentiviral human GATA3 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Human TRPV1 Pre-designed siRNA Set A
SI017433A 1 Each

Human TRPV1 Pre-designed siRNA Set A

Sign In for Pricing
View Details