Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Them6 Rabbit Polyclonal Antibody (FITC)

Them6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

4930572J05Rik

UniProt

Q80ZW2

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse 4930572J05Rik

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RRSLRLFEPFEVHTRLQGWDDRAFYLEARFVSLRDGFVCALLRFRQHVLG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_941009

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MT-ND2/NADH-ubiquinone oxidoreductase chain 2 ELISA Kit
MBS2907259-01 48 Well

Human MT-ND2/NADH-ubiquinone oxidoreductase chain 2 ELISA Kit

Sign In for Pricing
View Details
Human MT-ND2/NADH-ubiquinone oxidoreductase chain 2 ELISA Kit
MBS2907259-02 96 Well

Human MT-ND2/NADH-ubiquinone oxidoreductase chain 2 ELISA Kit

Sign In for Pricing
View Details
Human MT-ND2/NADH-ubiquinone oxidoreductase chain 2 ELISA Kit
MBS2907259-03 5x 96 Well

Human MT-ND2/NADH-ubiquinone oxidoreductase chain 2 ELISA Kit

Sign In for Pricing
View Details
Human MT-ND2/NADH-ubiquinone oxidoreductase chain 2 ELISA Kit
MBS2907259-04 10x 96 Well

Human MT-ND2/NADH-ubiquinone oxidoreductase chain 2 ELISA Kit

Sign In for Pricing
View Details
Murashige and Skoog Modified Vitamins (1000X) (MS Modified Vitamins) (Powder) discontinued
299716-01 5x 30 g

Murashige and Skoog Modified Vitamins (1000X) (MS Modified Vitamins) (Powder) discontinued

Sign In for Pricing
View Details
Murashige and Skoog Modified Vitamins (1000X) (MS Modified Vitamins) (Powder) discontinued
299716-02 10 x 30 g

Murashige and Skoog Modified Vitamins (1000X) (MS Modified Vitamins) (Powder) discontinued

Sign In for Pricing
View Details