Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A4GALT Rabbit Polyclonal Antibody (Biotin)

A4GALT Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P1, PK, Gb3S, P (k), P1PK, A14GALT, A4GALT1

UniProt

Q9NPC4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human A4GALT

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VLNGAFLAFERRHEFMALCMRDFVDHYNGWIWGHQGPQLLTRVFKKWCSI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_059132

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycophorin A / CD235a (Erythrocyte Marker) (N/A), CF594 conjugate, 0.1mg/mL
BNC941736-500 1x 500 µL

Glycophorin A / CD235a (Erythrocyte Marker) (N/A), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prohibitin (Mitochondrial Marker) (PHB/1882), CF405S conjugate, 0.1mg/mL
BNC041882-100 1x 100 µL

Prohibitin (Mitochondrial Marker) (PHB/1882), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (CLIP/1133), CF647 conjugate, 0.1mg/mL
BNC471133-500 1x 500 µL

CD74 (CLIP/1133), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Live or Dead™ Fixable Dead Cell Staining Kit *NIR Fluorescence*
22605-AAT 200 Tests

Live or Dead™ Fixable Dead Cell Staining Kit *NIR Fluorescence*

Sign In for Pricing
View Details
Calponin-1 (CALP), Biotin conjugate, 0.1mg/mL
BNCB0831-100 1x 100 µL

Calponin-1 (CALP), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nucleophosmin (Acute Myeloid Leukemia Marker) (NPM1/3398), CF647 conjugate, 0.1mg/mL
BNC473398-500 1x 500 µL

Nucleophosmin (Acute Myeloid Leukemia Marker) (NPM1/3398), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details