Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A4GALT Rabbit Polyclonal Antibody (FITC)

A4GALT Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P1, PK, Gb3S, P (k), P1PK, A14GALT, A4GALT1

UniProt

Q9NPC4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human A4GALT

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VLNGAFLAFERRHEFMALCMRDFVDHYNGWIWGHQGPQLLTRVFKKWCSI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_059132

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human E3 ubiquitin-protein ligase SIAH1 (SIAH1)
RPC29928-01 20 µg

Recombinant Human E3 ubiquitin-protein ligase SIAH1 (SIAH1)

Sign In for Pricing
View Details
Recombinant Human E3 ubiquitin-protein ligase SIAH1 (SIAH1)
RPC29928-02 100 µg

Recombinant Human E3 ubiquitin-protein ligase SIAH1 (SIAH1)

Sign In for Pricing
View Details
Recombinant Human E3 ubiquitin-protein ligase SIAH1 (SIAH1)
RPC29928-03 1 mg

Recombinant Human E3 ubiquitin-protein ligase SIAH1 (SIAH1)

Sign In for Pricing
View Details
Anti-UCK (UCK1) Mouse Monoclonal Antibody [Clone ID: OTI4C2]
M08569 100 µL

Anti-UCK (UCK1) Mouse Monoclonal Antibody [Clone ID: OTI4C2]

Sign In for Pricing
View Details
Pum1 sgRNA CRISPR Lentivector set (Mouse)
K4820301 3x 1.0 µg

Pum1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Mouse Tmem145 Pre-designed siRNA Set B
SI114773B 1 Each

Mouse Tmem145 Pre-designed siRNA Set B

Sign In for Pricing
View Details