Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

A4GALT Rabbit Polyclonal Antibody (HRP)

A4GALT Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P1, PK, Gb3S, P (k), P1PK, A14GALT, A4GALT1

UniProt

Q9NPC4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human A4GALT

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VLNGAFLAFERRHEFMALCMRDFVDHYNGWIWGHQGPQLLTRVFKKWCSI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_059132

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C3 Recombinant Rabbit monoclonal Antibody
HA723984 100 µL

Complement C3 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Cartilage
CS631039 5x 5 µm

Frozen Tissue Sections, Cartilage

Sign In for Pricing
View Details
trans-4-Aminocyclohexanol Hydrochloride
TRC-A603696-1G 1 g

trans-4-Aminocyclohexanol Hydrochloride

Sign In for Pricing
View Details
Forget-Me-NotTM EvaGreen® qPCR Master Mix with ROX (2000 reactions)
#31042-20mL 2x 10 mL

Forget-Me-NotTM EvaGreen® qPCR Master Mix with ROX (2000 reactions)

Sign In for Pricing
View Details
PPP1R11 Human Gene Knockout Kit (CRISPR)
KN414995 1 Kit

PPP1R11 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Spectrin beta III (SPTBN2) (rSPTBN2/1778), CF740 conjugate, 0.1mg/mL
BNC743647-500 1x 500 µL

Spectrin beta III (SPTBN2) (rSPTBN2/1778), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details