Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM104 Rabbit Polyclonal Antibody (Biotin)

TMEM104 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FLJ00021, FLJ20255

UniProt

Q8NE00

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TMEM104

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GDLAIYAAAVPFSLMQVTCSATGNDSCGVEADTKYNDTDRCWGPLRRVDA

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

EAW89200

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

M6PR (cation dependent) Recombinant Rabbit monoclonal Antibody
HA750681 100 µL

M6PR (cation dependent) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Fluoro 2-Deoxy-2-fluoro-3,4,6-tri-O-acetyl-D-mannopyranoside
TRC-F590300-10MG 10 mg

Fluoro 2-Deoxy-2-fluoro-3,4,6-tri-O-acetyl-D-mannopyranoside

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Rat IgG2a, κ Isotype Control[2A3]
E-AB-F09832J-01 20 Tests

PerCP/Cyanine5.5 Rat IgG2a, κ Isotype Control[2A3]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Rat IgG2a, κ Isotype Control[2A3]
E-AB-F09832J-02 100 Tests

PerCP/Cyanine5.5 Rat IgG2a, κ Isotype Control[2A3]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Rat IgG2a, κ Isotype Control[2A3]
E-AB-F09832J-03 2x 100 Tests

PerCP/Cyanine5.5 Rat IgG2a, κ Isotype Control[2A3]

Sign In for Pricing
View Details
S100P Human Gene Knockout Kit (CRISPR)
KN401533 1 Kit

S100P Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details