Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM104 Rabbit Polyclonal Antibody (HRP)

TMEM104 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ00021, FLJ20255

UniProt

Q8NE00

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TMEM104

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GDLAIYAAAVPFSLMQVTCSATGNDSCGVEADTKYNDTDRCWGPLRRVDA

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

EAW89200

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hCAP-H Polyclonal Antibody
MBS9243877-01 0.1 mL

hCAP-H Polyclonal Antibody

Sign In for Pricing
View Details
hCAP-H Polyclonal Antibody
MBS9243877-02 5x 0.1 mL

hCAP-H Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Cystatin C Antibody (Cyst13) [Alexa Fluor 647]
NBP1-05763AF647 0.2 mL

Mouse Monoclonal Cystatin C Antibody (Cyst13) [Alexa Fluor 647]

Sign In for Pricing
View Details
Human GPR89B shRNA Plasmid
abx959777-01 150 µg

Human GPR89B shRNA Plasmid

Sign In for Pricing
View Details
Human GPR89B shRNA Plasmid
abx959777-02 300 µg

Human GPR89B shRNA Plasmid

Sign In for Pricing
View Details
Human PVR Protein, Fc Tag
E40KMPH1219 20 µg

Human PVR Protein, Fc Tag

Sign In for Pricing
View Details