Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM161A Rabbit Polyclonal Antibody (Biotin)

TMEM161A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AROS29, AROS-29

UniProt

Q9NX61

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TMEM161A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LLAMLVQVVREETLELGLEPGLASMTQNLEPLLKKQGWDWALPVAKLAIR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_060284

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GIMAP5 (GTPase IMAP Family Member 5, Immunity-associated Nucleotide 4-like 1 Protein, IAN4L1, Immunity-associated Nucleotide 5 Protein, hIAN5, IAN-5, Immunity-associated Protein 3, IMAP3, FLJ11296) (Biotin)
MBS6379771-01 0.1 mL

GIMAP5 (GTPase IMAP Family Member 5, Immunity-associated Nucleotide 4-like 1 Protein, IAN4L1, Immunity-associated Nucleotide 5 Protein, hIAN5, IAN-5, Immunity-associated Protein 3, IMAP3, FLJ11296) (Biotin)

Sign In for Pricing
View Details
GIMAP5 (GTPase IMAP Family Member 5, Immunity-associated Nucleotide 4-like 1 Protein, IAN4L1, Immunity-associated Nucleotide 5 Protein, hIAN5, IAN-5, Immunity-associated Protein 3, IMAP3, FLJ11296) (Biotin)
MBS6379771-02 5x 0.1 mL

GIMAP5 (GTPase IMAP Family Member 5, Immunity-associated Nucleotide 4-like 1 Protein, IAN4L1, Immunity-associated Nucleotide 5 Protein, hIAN5, IAN-5, Immunity-associated Protein 3, IMAP3, FLJ11296) (Biotin)

Sign In for Pricing
View Details
CRISPLD2 Antibody, FITC conjugated
MBS7051398-01 0.05 mg

CRISPLD2 Antibody, FITC conjugated

Sign In for Pricing
View Details
CRISPLD2 Antibody, FITC conjugated
MBS7051398-02 0.1 mg

CRISPLD2 Antibody, FITC conjugated

Sign In for Pricing
View Details
CRISPLD2 Antibody, FITC conjugated
MBS7051398-03 5x 0.1 mg

CRISPLD2 Antibody, FITC conjugated

Sign In for Pricing
View Details
GNPAT Antibody (Biotin)
orb414764-01 50 µg

GNPAT Antibody (Biotin)

Sign In for Pricing
View Details