Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM127 Rabbit Polyclonal Antibody (HRP)

TMEM127 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ20507, FLJ22257

UniProt

O75204

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TMEM127

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AFLLDVFGPKHPALKITRRYAFAHILTVLQCATVIGFSYWASELILAQQQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060319

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1R Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F1]
TA800085AM 100 µL

C1R Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1F1]

Sign In for Pricing
View Details
GATA4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9F9]
TA500091AM 100 µL

GATA4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9F9]

Sign In for Pricing
View Details
RASGRP 4 (RASGRP4) (NM_001146206) Human Over-expression Lysate
LY431425 100 µg

RASGRP 4 (RASGRP4) (NM_001146206) Human Over-expression Lysate

Sign In for Pricing
View Details
Caveolin 3 (CAV3) (N-term) Rabbit Polyclonal Antibody
AP17187PU-N 400 µL

Caveolin 3 (CAV3) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/760 + KRT7/903), Biotin conjugate, 0.1mg/mL
BNCB0906-500 1x 500 µL

Cytokeratin 7 (KRT7/760 + KRT7/903), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E2F4 Recombinant Rabbit monoclonal Antibody
HA750625 100 µL

E2F4 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details