Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUSD4 Rabbit Polyclonal Antibody (HRP)

SUSD4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PRO222

UniProt

Q5VX71

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SUSD4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MYHGMNPSNGDGFLEQQQQQQQPQSPQRLLAVILWFQLALCFGPAQLTGG

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_001032252

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Glia Maturation Factor Gamma (GMFG) ELISA Kit
MBS9923222-01 48 Well

Mouse Glia Maturation Factor Gamma (GMFG) ELISA Kit

Sign In for Pricing
View Details
Mouse Glia Maturation Factor Gamma (GMFG) ELISA Kit
MBS9923222-02 96 Well

Mouse Glia Maturation Factor Gamma (GMFG) ELISA Kit

Sign In for Pricing
View Details
Mouse Glia Maturation Factor Gamma (GMFG) ELISA Kit
MBS9923222-03 5x 96 Well

Mouse Glia Maturation Factor Gamma (GMFG) ELISA Kit

Sign In for Pricing
View Details
Mouse Glia Maturation Factor Gamma (GMFG) ELISA Kit
MBS9923222-04 10x 96 Well

Mouse Glia Maturation Factor Gamma (GMFG) ELISA Kit

Sign In for Pricing
View Details
Anti-ZAP70 Antibody Picoband® (monoclonal, 6F12) Fluoro550 Conjugated
M00754-4-Fluoro550 100 µg/Vial

Anti-ZAP70 Antibody Picoband® (monoclonal, 6F12) Fluoro550 Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Cblc shRNA (UAS) - Lentiviral mouse Cblc shRNA (UAS, iRFP) plasmid
GTR15178936 1 Vial

Lentiviral mouse Cblc shRNA (UAS) - Lentiviral mouse Cblc shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details